PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV28764.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family SBP
Protein Properties Length: 287aa    MW: 32342.3 Da    PI: 9.6651
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV28764.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.62e-392399278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
                C v+gC+adl  + +yhrrhkvCe+hsk+p+v++ g+ qrfCqqCsrfh+l efDe krsCr+rL+ hn+rrrk+q+
  KZV28764.1 23 CLVDGCNADLRLCGNYHRRHKVCEIHSKTPKVIIGGRDQRFCQQCSRFHSLVEFDEVKRSCRKRLDWHNRRRRKPQP 99
                **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-301884IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.3082097IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-3622101IPR004333Transcription factor, SBP-box
PfamPF031102.9E-292396IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MEPSALFSGQ WKRAKAERNI GSCLVDGCNA DLRLCGNYHR RHKVCEIHSK TPKVIIGGRD  60
QRFCQQCSRF HSLVEFDEVK RSCRKRLDWH NRRRRKPQPT SVFSRNSGFM SSSQQATRFY  120
SFSSPQILAS GVIVEPDNRT VADKNQLPSY KPVNQLQFIQ GSDPAAVVHE TSVYQPFVNP  180
KSVSGRSKIF SDQARSLLSS AHTLTQEFGL SQAFQTEPIP PQTQSVDQNW LYNNDLGPFS  240
LVEDVKPVVS AAIYHGGNVS DAINFLEMNR RGSSTNGANQ TLTFLWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-2823961184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17996KRSCRKRLDWHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016482449.11e-75PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_016482450.11e-75PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_016482451.11e-75PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_016482452.11e-75PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_016482453.11e-75PREDICTED: squamosa promoter-binding-like protein 16
TrEMBLA0A125SZN96e-73A0A125SZN9_TOBAC; Squamosa promoter binding protein NtabSPL13
STRINGPGSC0003DMT4000563733e-72(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-39SBP family protein